Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis delta virus genotype I Large delta antigen

Recombinant Hepatitis delta virus genotype I Large delta antigen is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Hepatitis delta virus genotype I (isolate Italian) (HDV) . Target Name: Hepatitis delta virus genotype I Large delta antigen. Target Synonyms: p27. Accession Number: P0C6L6. Expression Region: 1~211aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hepatitis delta virus genotype I Large delta antigen is a purified Recombinant Protein.

Accession Number

P0C6L6

Expression Region

1~211aa

Host

Baculovirus

Target

Hepatitis delta virus genotype I Large delta antigen

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P27

Species

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Protein Name

Recombinant Protein

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPIHBP1 Protein Vector (Human) (pPB-N-His)
PV052714 500 ng

GPIHBP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
FLVCR2 (NM_001195283) Human Over-expression Lysate
LS055640-20ug 20 µg

FLVCR2 (NM_001195283) Human Over-expression Lysate

Sign In for Pricing
View Details
1190005I06Rik (m) -PR
sc-108199-PR 10 µM - 20 µL

1190005I06Rik (m) -PR

Sign In for Pricing
View Details
TSPYL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
48633154 3x 1.0 µg DNA

TSPYL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
3,6-Dichloro-1-methyl-1H-indole-2-carboxylic acid
FEC22453-01 50 mg

3,6-Dichloro-1-methyl-1H-indole-2-carboxylic acid

Sign In for Pricing
View Details
3,6-Dichloro-1-methyl-1H-indole-2-carboxylic acid
FEC22453-02 0.5 g

3,6-Dichloro-1-methyl-1H-indole-2-carboxylic acid

Sign In for Pricing
View Details