Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis delta virus genotype I Large delta antigen

Recombinant Hepatitis delta virus genotype I Large delta antigen is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Hepatitis delta virus genotype I (isolate Italian) (HDV) . Target Name: Hepatitis delta virus genotype I Large delta antigen. Target Synonyms: p27. Accession Number: P0C6L6. Expression Region: 1~211aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hepatitis delta virus genotype I Large delta antigen is a purified Recombinant Protein.

Accession Number

P0C6L6

Expression Region

1~211aa

Host

Baculovirus

Target

Hepatitis delta virus genotype I Large delta antigen

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P27

Species

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Protein Name

Recombinant Protein

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SDAD1 Antibody [Janelia Fluor 646]
NBP2-98637JF646 0.1 mL

Rabbit Polyclonal SDAD1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
KCNE4 CRISPRa sgRNA lentivector (set of three targets)(Human)
25353121 3x 1.0µg DNA

KCNE4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1354147-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1354147-02 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1354147-03 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1354147-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details