Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SFTPB. Target Synonyms: 18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL (Phe) . Accession Number: P07988. Expression Region: 201~279aa. Tag Info: N-Terminal Mbp-Tagged. Theoretical MW: 50.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) is a purified Recombinant Protein.

Accession Number

P07988

Expression Region

201~279aa

Host

Baculovirus

Target

SFTPB

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL (Phe)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AglB Polyclonal Antibody, FITC Conjugated
A55040-100 100 µL

AglB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti Mouse CD54 Flow Cytometry Monoclonal Clone YN1174 PE Ready To Use 100 Tests
IRTAMSCD54YN1174CPE100 100 Tests

Anti Mouse CD54 Flow Cytometry Monoclonal Clone YN1174 PE Ready To Use 100 Tests

Sign In for Pricing
View Details
STK33 Rabbit Polyclonal Antibody
TA350458 100 µL

STK33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lphn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4147604 1.0 µg DNA

Lphn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human LAMP3 shRNA (UAS) - Lentiviral human LAMP3 shRNA (UAS, RFP) (25)
GTR15324134 1 Vial

Lentiviral human LAMP3 shRNA (UAS) - Lentiviral human LAMP3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse EBI3 ELISA Kit
orb439239-01 48 Tests

Mouse EBI3 ELISA Kit

Sign In for Pricing
View Details