Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein-lysine 6-oxidase (LOX)

Recombinant Human Protein-lysine 6-oxidase (LOX) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LOX. Target Synonyms: Lysyl oxidase. Accession Number: P28300. Expression Region: 169~417aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged. Theoretical MW: 73kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein-lysine 6-oxidase (LOX) is a purified Recombinant Protein.

Accession Number

P28300

Expression Region

169~417aa

Host

Baculovirus

Target

LOX

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

73kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Lysyl oxidase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-S-(2-hydroxy-1-phenylethyl)-L-cysteine-d3 + N-Acetyl-S-(2-hydroxy-2-phenylethyl)-L-cysteine-d3 (Mixture)
TRC-A179027-1MG 1 mg

N-Acetyl-S-(2-hydroxy-1-phenylethyl)-L-cysteine-d3 + N-Acetyl-S-(2-hydroxy-2-phenylethyl)-L-cysteine-d3 (Mixture)

Sign In for Pricing
View Details
TMEM144 (NM_018342) Human Over-expression Lysate
LC402667 20 µg

TMEM144 (NM_018342) Human Over-expression Lysate

Sign In for Pricing
View Details
SHC (SHC1) Rabbit Polyclonal Antibody
TA370216 100 µL

SHC (SHC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ammonium-15N hydroxide Solution ~14 N in H2O, 98 Atom % 15N
TRC-A634036-250MG 250 mg

Ammonium-15N hydroxide Solution ~14 N in H2O, 98 Atom % 15N

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Orange Fluorescence Excited at 405 nm*
22830-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Orange Fluorescence Excited at 405 nm*

Sign In for Pricing
View Details
Colloidal Gold Conjugated lris hybrid Lectin (Dutch Iris) -IRA-,  30nm
GP-8010-30 1 mL

Colloidal Gold Conjugated lris hybrid Lectin (Dutch Iris) -IRA-, 30nm

Sign In for Pricing
View Details