Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: HINT1. Target Synonyms: Adenosine 5'-monophosphoramidaseP13.7. Accession Number: P80912. Expression Region: 2~126aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) is a purified Recombinant Protein.

Accession Number

P80912

Expression Region

2~126aa

Host

Mammalian Cells

Target

HINT1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adenosine 5'-monophosphoramidaseP13.7

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERF Antibody
A13623-50UG 50 µg

ERF Antibody

Sign In for Pricing
View Details
Morpholine-d8 Hydrochloride
C04869 1 mg

Morpholine-d8 Hydrochloride

Sign In for Pricing
View Details
BST2 (CD317, TETHERIN, Bone Marrow Stromal Antigen 2) discontinued
218839-01 20 µL

BST2 (CD317, TETHERIN, Bone Marrow Stromal Antigen 2) discontinued

Sign In for Pricing
View Details
BST2 (CD317, TETHERIN, Bone Marrow Stromal Antigen 2) discontinued
218839-02 100 µL

BST2 (CD317, TETHERIN, Bone Marrow Stromal Antigen 2) discontinued

Sign In for Pricing
View Details
Recombinant Canine Adenovirus Serotype 1 Core-Capsid Bridging Protein (L2)
VG2C104-01 1 mg

Recombinant Canine Adenovirus Serotype 1 Core-Capsid Bridging Protein (L2)

Sign In for Pricing
View Details
Recombinant Canine Adenovirus Serotype 1 Core-Capsid Bridging Protein (L2)
VG2C104-02 100 µg

Recombinant Canine Adenovirus Serotype 1 Core-Capsid Bridging Protein (L2)

Sign In for Pricing
View Details