Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Renin receptor (ATP6AP2)

Recombinant Human Renin receptor (ATP6AP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ATP6AP2. Target Synonyms: ATP6M8-9; V-ATPase M8.9 subunit. Accession Number: O75787. Expression Region: 17~350aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Renin receptor (ATP6AP2) is a purified Recombinant Protein.

Accession Number

O75787

Expression Region

17~350aa

Host

E. coli

Target

ATP6AP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ATP6M8-9; V-ATPase M8.9 subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MTRNR2L3 shRNA (UAS) - Lentiviral human MTRNR2L3 shRNA (UAS, RFP) (25)
GTR15319046 1 Vial

Lentiviral human MTRNR2L3 shRNA (UAS) - Lentiviral human MTRNR2L3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MAD2L1bindingprotein Antibody
orb2808757 100 µL

MAD2L1bindingprotein Antibody

Sign In for Pricing
View Details
Human Chitinase 3 Like Protein 2 (CHI3L2) ELISA Kit
EKL56276 96 Tests

Human Chitinase 3 Like Protein 2 (CHI3L2) ELISA Kit

Sign In for Pricing
View Details
CD163L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV647527 1.0 µg DNA

CD163L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TSC1 Rabbit Polyclonal Antibody
orb5378-01 50 μL

TSC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSC1 Rabbit Polyclonal Antibody
orb5378-02 100 µL

TSC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details