Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Adenylate kinase (adk)

Recombinant Shigella flexneri Adenylate kinase (adk) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: adk. Target Synonyms: ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase. Accession Number: Q83M40. Expression Region: 1~214aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 43.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Shigella flexneri Adenylate kinase (adk) is a purified Recombinant Protein.

Accession Number

Q83M40

Expression Region

1~214aa

Host

E. coli

Target

Adk

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase

Species

Shigella flexneri

Protein Name

Recombinant Protein

AA Sequence

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CFI Protein, His Tag
32-18375-100 100 µg

Human CFI Protein, His Tag

Sign In for Pricing
View Details
Fibronectin, Gelatin Binding Domain (APC)
F4215-75-APC 100 µL

Fibronectin, Gelatin Binding Domain (APC)

Sign In for Pricing
View Details
Olfr748 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33417114 3x 1.0 µg

Olfr748 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SEPT14 Protein Lysate (Human) with C-Ha Tag
43396031 100 µg

SEPT14 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Cyclophilin F Rabbit Polyclonal Antibody (PerCP)
orb2391736 100 µL

Cyclophilin F Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Proteinase 3 Antibody / PRTN3
R34244-100UG 100 µg

Proteinase 3 Antibody / PRTN3

Sign In for Pricing
View Details