Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Adenylate kinase (adk)

Recombinant Shigella flexneri Adenylate kinase (adk) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: adk. Target Synonyms: ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase. Accession Number: Q83M40. Expression Region: 1~214aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 43.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Shigella flexneri Adenylate kinase (adk) is a purified Recombinant Protein.

Accession Number

Q83M40

Expression Region

1~214aa

Host

E. coli

Target

Adk

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase

Species

Shigella flexneri

Protein Name

Recombinant Protein

AA Sequence

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Biosimilar Antibody
orb2670528-01 50 µg

CD19 Biosimilar Antibody

Sign In for Pricing
View Details
CD19 Biosimilar Antibody
orb2670528-02 100 µg

CD19 Biosimilar Antibody

Sign In for Pricing
View Details
Genesig® Standard kit for B.bronchiseptica
Z-Path-B.bronchiseptica-std 150 Tests

Genesig® Standard kit for B.bronchiseptica

Sign In for Pricing
View Details
L-Octahydroindole-2- carboxylic acid
CSB-DT3383 1 g

L-Octahydroindole-2- carboxylic acid

Sign In for Pricing
View Details
AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (FITC)
243215-FITC 100 µL

AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (FITC)

Sign In for Pricing
View Details
Monkey C5B-9 ELISA Kit
EMKC0012 96 Tests

Monkey C5B-9 ELISA Kit

Sign In for Pricing
View Details