Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Cationic trypsin

Recombinant Dog Cationic trypsin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: Dog Cationic trypsin. Target Synonyms: Cationic trypsin; EC 3.4.21.4. Accession Number: P06871. Expression Region: 24~246aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Dog Cationic trypsin is a purified Recombinant Protein.

Accession Number

P06871

Expression Region

24~246aa

Host

E. coli

Target

Dog Cationic trypsin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cationic trypsin; EC 3.4.21.4

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP13A1 Recombinant Protein Antigen
NBP2-30717PEP 0.1 mL

ATP13A1 Recombinant Protein Antigen

Sign In for Pricing
View Details
SNHG6 AAV siRNA Pooled Vector
44559161 1.0 µg

SNHG6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Nck beta Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-4280R-BF594 100 µL

Nck beta Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Olfr134 CRISPR/Cas9 KO Plasmid (m)
sc-434938 20 µg

Olfr134 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
1700028K03Rik ORF Vector (Mouse) (pORF)
ORF036784 1.0 µg DNA

1700028K03Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
AKR1C4 (Aldo-keto Reductase Family 1 Member C4, 3-alpha-HSD1, 3-alpha-hydroxysteroid Dehydrogenase Type I, Chlordecone Reductase, CDR, Dihydrodiol Dehydrogenase 4, DD-4, DD4, HAKRA, CHDR) discontinued
A1334-70V1 50 µg

AKR1C4 (Aldo-keto Reductase Family 1 Member C4, 3-alpha-HSD1, 3-alpha-hydroxysteroid Dehydrogenase Type I, Chlordecone Reductase, CDR, Dihydrodiol Dehydrogenase 4, DD-4, DD4, HAKRA, CHDR) discontinued

Sign In for Pricing
View Details