Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail)

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica. Target Name: ail. Target Synonyms: ailAttachment invasion locus protein. Accession Number: P16454. Expression Region: 24~178aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein.

Accession Number

P16454

Expression Region

24~178aa

Host

E. coli

Target

Ail

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AilAttachment invasion locus protein

Species

Yersinia enterocolitica

Protein Name

Recombinant Protein

AA Sequence

ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-01 0.1 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-02 0.2 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-03 0.5 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-04 1 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-05 5 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)
MBS2042050-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Cadherin, Retinal (RCAD)

Sign In for Pricing
View Details