Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail)

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica. Target Name: ail. Target Synonyms: ailAttachment invasion locus protein. Accession Number: P16454. Expression Region: 24~178aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein.

Accession Number

P16454

Expression Region

24~178aa

Host

E. coli

Target

Ail

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AilAttachment invasion locus protein

Species

Yersinia enterocolitica

Protein Name

Recombinant Protein

AA Sequence

ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Modifier 2, SUMO-2, Ubiquitin-like Protein SMT3B, SMT3 Homolog 2, Sentrin-2, HSMT3, SUMO-3, SMT3B, SMT3H2, Small Ubiquitin-related Modifier 3, SUMO-3, Ubiquitin-like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1) (PE) discontinued
S8026-01A-PE 200 µL

SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Modifier 2, SUMO-2, Ubiquitin-like Protein SMT3B, SMT3 Homolog 2, Sentrin-2, HSMT3, SUMO-3, SMT3B, SMT3H2, Small Ubiquitin-related Modifier 3, SUMO-3, Ubiquitin-like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1) (PE) discontinued

Sign In for Pricing
View Details
Porcine Interleukin 1 Alpha (IL1a) ELISA Kit
RD-IL1a-p-01 96 Tests

Porcine Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 1 Alpha (IL1a) ELISA Kit
RD-IL1a-p-02 48 Tests

Porcine Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human FABP6/ I-BABP Protein, GST, E.coli-100ug
QP6015-ec-100ug 100ug

Recombinant Human FABP6/ I-BABP Protein, GST, E.coli-100ug

Sign In for Pricing
View Details
TMEM9 Antibody
A37014-50UG 50 µg

TMEM9 Antibody

Sign In for Pricing
View Details
Recombinant Pasteurella multocida 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1022522-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details