Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail)

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica. Target Name: ail. Target Synonyms: ailAttachment invasion locus protein. Accession Number: P16454. Expression Region: 24~178aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein.

Accession Number

P16454

Expression Region

24~178aa

Host

E. coli

Target

Ail

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AilAttachment invasion locus protein

Species

Yersinia enterocolitica

Protein Name

Recombinant Protein

AA Sequence

ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAALC Recombinant Protein (Rat)
RP191795 100 µg

BAALC Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal DDX60 Antibody [Janelia Fluor 549]
NBP2-81712JF549 0.1 mL

Rabbit Polyclonal DDX60 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Rabbit Polyclonal RREB1 Antibody
NBP2-56824-25ul 25 µL

Rabbit Polyclonal RREB1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ercc6l shRNA (UAS) - Lentiviral mouse Ercc6l shRNA (UAS, GFP) plasmid
GTR15180430 1 Vial

Lentiviral mouse Ercc6l shRNA (UAS) - Lentiviral mouse Ercc6l shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Dlc1 Rat shRNA Plasmid (Locus ID 58834)
TR708376 1 Kit

Dlc1 Rat shRNA Plasmid (Locus ID 58834)

Sign In for Pricing
View Details
Human Musashi-1 MAb (Clone 282613)
MAB2628 100 µg

Human Musashi-1 MAb (Clone 282613)

Sign In for Pricing
View Details