Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer)

Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Gfer. Target Synonyms: Augmenter of liver regeneration. Accession Number: Q63042. Expression Region: 1~198aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 38.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer) is a purified Recombinant Protein.

Accession Number

Q63042

Expression Region

1~198aa

Host

E. coli

Target

Gfer

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Augmenter of liver regeneration

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL
BNC882037-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL
BNC400841-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF640R conjugate, 0.1mg/mL
BNC401799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF647 conjugate, 0.1mg/mL
BNC472296-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL
BNC042886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details