Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Periplasmic murein peptide-binding protein (mppA)

Recombinant E. coli Periplasmic murein peptide-binding protein (mppA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: mppA. Target Synonyms: mppA; ynaH; b1329; JW1322; Periplasmic murein peptide-binding protein. Accession Number: P77348. Expression Region: 23~537aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 73.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Periplasmic murein peptide-binding protein (mppA) is a purified Recombinant Protein.

Accession Number

P77348

Expression Region

23~537aa

Host

E. coli

Target

MppA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

73.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MppA; ynaH; b1329; JW1322; Periplasmic murein peptide-binding protein

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NVL Antibody (C-term)
orb1434641-01 50 µL

NVL Antibody (C-term)

Sign In for Pricing
View Details
NVL Antibody (C-term)
orb1434641-02 100 µL

NVL Antibody (C-term)

Sign In for Pricing
View Details
Mouse DSPG3 MAb (Clone 340908)
MAB2875-SP 25 µg

Mouse DSPG3 MAb (Clone 340908)

Sign In for Pricing
View Details
CMTM2 Antibody
CSB-PA916076-01 50 μL

CMTM2 Antibody

Sign In for Pricing
View Details
CMTM2 Antibody
CSB-PA916076-02 100 µL

CMTM2 Antibody

Sign In for Pricing
View Details
Nori® Bovine IL-7 ELISA Kit
GR112004 96 Well

Nori® Bovine IL-7 ELISA Kit

Sign In for Pricing
View Details