Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Gzma. Target Synonyms: Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1. Accession Number: P11032. Expression Region: 29~260aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein.

Accession Number

P11032

Expression Region

29~260aa

Host

E. coli

Target

Gzma

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-B2M-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sycp3 (NM_013041) Rat Tagged Lenti ORF Clone
RR212241L3 10 µg

Sycp3 (NM_013041) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FGFBP1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
20513156 3x 1.0 µg DNA

FGFBP1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Zfp280d Pre-designed siRNA Set B
SI116384B 1 Each

Mouse Zfp280d Pre-designed siRNA Set B

Sign In for Pricing
View Details
LY6K siRNA (Human)
orb1858066-01 15 nmol

LY6K siRNA (Human)

Sign In for Pricing
View Details
LY6K siRNA (Human)
orb1858066-02 30 nmol

LY6K siRNA (Human)

Sign In for Pricing
View Details
Ammonium Molybdate, Tetrahydrate, ACS
259919-01 250 g

Ammonium Molybdate, Tetrahydrate, ACS

Sign In for Pricing
View Details