Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Gzma. Target Synonyms: Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1. Accession Number: P11032. Expression Region: 29~260aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein.

Accession Number

P11032

Expression Region

29~260aa

Host

E. coli

Target

Gzma

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-B2M-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C22orf31 Antibody
E30AC2981 100 µL

C22orf31 Antibody

Sign In for Pricing
View Details
hsa-miR-372-3p miRNA Antagomir
MBS8316109-01 10 nmol

hsa-miR-372-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-372-3p miRNA Antagomir
MBS8316109-02 20 nmol

hsa-miR-372-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-372-3p miRNA Antagomir
MBS8316109-03 5x 20 nmol

hsa-miR-372-3p miRNA Antagomir

Sign In for Pricing
View Details
OR52N3P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV739233 1.0 µg DNA

OR52N3P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Klrb1f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4209906 1.0 µg DNA

Klrb1f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details