Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atlantic salmon Vertebrate ancient opsin

Recombinant Atlantic salmon Vertebrate ancient opsin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmo salar (Atlantic salmon) . Target Name: Atlantic salmon Vertebrate ancient opsin. Target Synonyms: Vertebrate ancient opsin. Accession Number: O13018. Expression Region: 1~75aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 22.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Atlantic salmon Vertebrate ancient opsin is a purified Recombinant Protein.

Accession Number

O13018

Expression Region

1~75aa

Host

E. coli

Target

Atlantic salmon Vertebrate ancient opsin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-B2M-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vertebrate ancient opsin

Species

Salmo salar (Atlantic salmon)

Protein Name

Recombinant Protein

AA Sequence

MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Period circadian protein homolog 1 (PER1) ELISA Kit
EK8580 48 Tests

Human Period circadian protein homolog 1 (PER1) ELISA Kit

Sign In for Pricing
View Details
PINK1 (Phospho- Thr313) Antibody
12842-01 50 µL

PINK1 (Phospho- Thr313) Antibody

Sign In for Pricing
View Details
PINK1 (Phospho- Thr313) Antibody
12842-02 100 µL

PINK1 (Phospho- Thr313) Antibody

Sign In for Pricing
View Details
FLJ27365 Rabbit Polyclonal Antibody (Cy5)
orb944153 100 µL

FLJ27365 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Human BEND6 Protein, His, E.coli-5ug
QP11153-5ug 5ug

Recombinant Human BEND6 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
Hypoxia Up Regulated 1 (HYOU1) BioAssayTM ELISA Kit (Human)
025746 96 Tests

Hypoxia Up Regulated 1 (HYOU1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details