Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain COL) . Target Name: clfA. Target Synonyms: Fibrinogen receptor AFibrinogen-binding protein A. Accession Number: Q5HHM8. Expression Region: 229~559aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 38.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein.

Accession Number

Q5HHM8

Expression Region

229~559aa

Host

Yeast

Target

ClfA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibrinogen receptor AFibrinogen-binding protein A

Species

Staphylococcus aureus (strain COL)

Protein Name

Recombinant Protein

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB37 (Ras-related Protein Rab-37) (FITC)
MBS6496389-01 0.1 mL

RAB37 (Ras-related Protein Rab-37) (FITC)

Sign In for Pricing
View Details
RAB37 (Ras-related Protein Rab-37) (FITC)
MBS6496389-02 5x 0.1 mL

RAB37 (Ras-related Protein Rab-37) (FITC)

Sign In for Pricing
View Details
ATP2C2 Protein Vector (Rat) (pPM-C-HA)
12693026 500 ng

ATP2C2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Bifunctional purine biosynthesis protein PurH (purH), partial
MBS1214285 Inquire

Recombinant Burkholderia mallei Bifunctional purine biosynthesis protein PurH (purH), partial

Sign In for Pricing
View Details
BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (MaxLight 405) discontinued
302284-ML405 100 µL

BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AKR1B1 polyclonal antibody
orb646542-01 50 μL

AKR1B1 polyclonal antibody

Sign In for Pricing
View Details