Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain COL) . Target Name: clfA. Target Synonyms: Fibrinogen receptor AFibrinogen-binding protein A. Accession Number: Q5HHM8. Expression Region: 229~559aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 38.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein.

Accession Number

Q5HHM8

Expression Region

229~559aa

Host

Yeast

Target

ClfA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibrinogen receptor AFibrinogen-binding protein A

Species

Staphylococcus aureus (strain COL)

Protein Name

Recombinant Protein

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin oligodendrocyte glycoprotein (MOG) (NM_206812) Human Tagged ORF Clone Lentiviral Particle
RC214382L4V 200 µL

Myelin oligodendrocyte glycoprotein (MOG) (NM_206812) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GAL3ST4, ID (GAL3ST4, Galactose-3-O-sulfotransferase 4, Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase) (MaxLight 490) discontinued
035884-ML490 100 µL

GAL3ST4, ID (GAL3ST4, Galactose-3-O-sulfotransferase 4, Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ELISpot Plus: Hamster IFN-γ (HRP)
3102-4HPW-2 2 Plates

ELISpot Plus: Hamster IFN-γ (HRP)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) STP2 Polyclonal Antibody
MBS9007606 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) STP2 Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PDZ And LIM Domain Protein 1 (PDLIM1)
MBS2083531-01 0.1 mL

FITC-Linked Polyclonal Antibody to PDZ And LIM Domain Protein 1 (PDLIM1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PDZ And LIM Domain Protein 1 (PDLIM1)
MBS2083531-02 0.2 mL

FITC-Linked Polyclonal Antibody to PDZ And LIM Domain Protein 1 (PDLIM1)

Sign In for Pricing
View Details