Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Homeobox protein engrailed-1 (EN1)

Recombinant Chicken Homeobox protein engrailed-1 (EN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: EN1. Target Synonyms: Gg-En-1Homeobox protein en-1. Accession Number: Q05916. Expression Region: 1~333aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 48.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chicken Homeobox protein engrailed-1 (EN1) is a purified Recombinant Protein.

Accession Number

Q05916

Expression Region

1~333aa

Host

E. coli

Target

EN1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-B2M-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gg-En-1Homeobox protein en-1

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)
MBS2060515-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Kallikrein 7 (KLK7)

Sign In for Pricing
View Details