Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus niger Aspergillopepsin-2

Recombinant Aspergillus niger Aspergillopepsin-2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: Aspergillus niger Aspergillopepsin-2. Target Synonyms: Acid protease AAspergillopepsin IIProctase A. Accession Number: P24665. Expression Region: 60~98aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Aspergillus niger Aspergillopepsin-2 is a purified Recombinant Protein.

Accession Number

P24665

Expression Region

60~98aa

Host

E. coli

Target

Aspergillus niger Aspergillopepsin-2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acid protease AAspergillopepsin IIProctase A

Species

Aspergillus niger

Protein Name

Recombinant Protein

AA Sequence

EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT7 Protein Vector (Human) (pPB-His-GST)
PV319251 500 ng

ACOT7 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)
MBS1185121-01 0.02 mg (E-Coli)

Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)

Sign In for Pricing
View Details
Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)
MBS1185121-02 0.1 mg (E-Coli)

Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)

Sign In for Pricing
View Details
Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)
MBS1185121-03 0.02 mg (Yeast)

Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)

Sign In for Pricing
View Details
Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)
MBS1185121-04 0.1 mg (Yeast)

Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)

Sign In for Pricing
View Details
Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)
MBS1185121-05 0.02 mg (Baculovirus)

Recombinant Vitis vinifera U1 small nuclear ribonucleoprotein C (VIT_07s0104g01170)

Sign In for Pricing
View Details