Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FCER1A. Target Synonyms: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha. Accession Number: P12319. Expression Region: 26~205aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein.

Accession Number

P12319

Expression Region

26~205aa

Host

E. coli

Target

FCER1A

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND1C (NM_024898) Human Recombinant Protein
TP306410M 100 µg

DENND1C (NM_024898) Human Recombinant Protein

Sign In for Pricing
View Details
SPATA46 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]
TA811093AM 100 µL

SPATA46 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details
Human Cytokine Receptor Like Factor 2 (CRLF2) ELISA Kit
RD-CRLF2-Hu-01 96 Tests

Human Cytokine Receptor Like Factor 2 (CRLF2) ELISA Kit

Sign In for Pricing
View Details
Human Cytokine Receptor Like Factor 2 (CRLF2) ELISA Kit
RD-CRLF2-Hu-02 48 Tests

Human Cytokine Receptor Like Factor 2 (CRLF2) ELISA Kit

Sign In for Pricing
View Details
Automatic Nitrogen Air Generator BGEN-501
BGEN-501 Each

Automatic Nitrogen Air Generator BGEN-501

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS647834 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details