Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FCER1A. Target Synonyms: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha. Accession Number: P12319. Expression Region: 26~205aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein.

Accession Number

P12319

Expression Region

26~205aa

Host

E. coli

Target

FCER1A

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16267114 3x 1.0 µg

Cldn13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Ccnc activation kit by CRISPRa
GA205425 1 Kit

Mouse Ccnc activation kit by CRISPRa

Sign In for Pricing
View Details
FEV shRNA (h) Lentiviral Particles
sc-37859-V 200 µL

FEV shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
SUMO1/Sentrin Specific Peptidase 1 (SENP1) Antibody
abx339515-01 50 µL

SUMO1/Sentrin Specific Peptidase 1 (SENP1) Antibody

Sign In for Pricing
View Details
SUMO1/Sentrin Specific Peptidase 1 (SENP1) Antibody
abx339515-02 100 µL

SUMO1/Sentrin Specific Peptidase 1 (SENP1) Antibody

Sign In for Pricing
View Details
Proline rich membrane anchor 1 (PRIMA1) Human shRNA Plasmid Kit (Locus ID 145270)
TL318970 1 Kit

Proline rich membrane anchor 1 (PRIMA1) Human shRNA Plasmid Kit (Locus ID 145270)

Sign In for Pricing
View Details