Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RuvB-like 2 (RUVBL2)

Recombinant Human RuvB-like 2 (RUVBL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RUVBL2. Target Synonyms: 48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta. Accession Number: Q9Y230. Expression Region: 2~463aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RuvB-like 2 (RUVBL2) is a purified Recombinant Protein.

Accession Number

Q9Y230

Expression Region

2~463aa

Host

E. coli

Target

RUVBL2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yeats4 (NM_026570) Mouse Tagged ORF Clone
MR202676 10 µg

Yeats4 (NM_026570) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CLPTM1 Recombinant Antibody, Biotin Conjugated
bsm-62519R-Biotin-01 20 µL

CLPTM1 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CLPTM1 Recombinant Antibody, Biotin Conjugated
bsm-62519R-Biotin-02 100 µL

CLPTM1 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
BUBBLE PADDLE RESERVOIR, Tumble Powered, 8 Channel, Polypropylene Reservoir, Sculpted Bottom, 1 Bubble Paddle, Parylene Coated, 9 Bubbles/Paddle, Mixes 125 mL, SLAS Footprint
VP 756B-4PPP 1 EACH

BUBBLE PADDLE RESERVOIR, Tumble Powered, 8 Channel, Polypropylene Reservoir, Sculpted Bottom, 1 Bubble Paddle, Parylene Coated, 9 Bubbles/Paddle, Mixes 125 mL, SLAS Footprint

Sign In for Pricing
View Details
HES5 Human Pre-designed siRNA Set A
HY-RS06138 1 Set

HES5 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
CAP2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-08675 0.1 mg

CAP2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details