Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RuvB-like 2 (RUVBL2)

Recombinant Human RuvB-like 2 (RUVBL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RUVBL2. Target Synonyms: 48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta. Accession Number: Q9Y230. Expression Region: 2~463aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RuvB-like 2 (RUVBL2) is a purified Recombinant Protein.

Accession Number

Q9Y230

Expression Region

2~463aa

Host

E. coli

Target

RUVBL2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARF siRNA (Human)
MBS8205000-01 15 nmol

NARF siRNA (Human)

Sign In for Pricing
View Details
NARF siRNA (Human)
MBS8205000-02 30 nmol

NARF siRNA (Human)

Sign In for Pricing
View Details
NARF siRNA (Human)
MBS8205000-03 5x 30 nmol

NARF siRNA (Human)

Sign In for Pricing
View Details
C1orf133 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14135111 3x 1.0 µg

C1orf133 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Serine Protease Inhibitor Kazal-Type 9 (SPINK9) Antibody
abx238181 100 µg

Serine Protease Inhibitor Kazal-Type 9 (SPINK9) Antibody

Sign In for Pricing
View Details
KIF9 3'UTR GFP Stable Cell Line
TU061765 1.0 mL

KIF9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details