Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma) . Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit alpha. Target Synonyms: Aggretin alpha chainRhodoaggretin subunit alpha. Accession Number: Q9I841. Expression Region: 1~136aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha is a purified Recombinant Protein.

Accession Number

Q9I841

Expression Region

1~136aa

Host

E. coli

Target

Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aggretin alpha chainRhodoaggretin subunit alpha

Species

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Protein Name

Recombinant Protein

AA Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details