Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD8A. Target Synonyms: T-lymphocyte differentiation antigen T8/Leu-2CD_antigen: CD8a. Accession Number: P01732. Expression Region: 22~182aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein.

Accession Number

P01732

Expression Region

22~182aa

Host

Yeast

Target

CD8A

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

T-lymphocyte differentiation antigen T8/Leu-2CD_antigen: CD8a

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lhx2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4452403 1.0 µg DNA

Lhx2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CRKL Protein, His, E.coli-5ug
QP11509-5ug 5ug

Recombinant Human CRKL Protein, His, E.coli-5ug

Sign In for Pricing
View Details
PRSS56 Peptide - N-terminal region
orb2005455 100 µg

PRSS56 Peptide - N-terminal region

Sign In for Pricing
View Details
SNRPF Rabbit Polyclonal Antibody (HRP)
orb2125595 100 µL

SNRPF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)
MBS6394967-01 0.1 mL

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)

Sign In for Pricing
View Details
SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)
MBS6394967-02 5x 0.1 mL

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)

Sign In for Pricing
View Details