Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin

Recombinant Clostridium pasteurianum Rubredoxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium pasteurianum. Target Name: Clostridium pasteurianum Rubredoxin. Target Synonyms: Rd. Accession Number: P00268. Expression Region: 1~54aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 22kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Clostridium pasteurianum Rubredoxin is a purified Recombinant Protein.

Accession Number

P00268

Expression Region

1~54aa

Host

E. coli

Target

Clostridium pasteurianum Rubredoxin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Rd

Species

Clostridium pasteurianum

Protein Name

Recombinant Protein

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADS1/Delta 5 desaturase Polyclonal Antibody
E55A04784 100 µg

FADS1/Delta 5 desaturase Polyclonal Antibody

Sign In for Pricing
View Details
DYNC1I2 (NM_001271789) Human Untagged Clone
SC333115 10 µg

DYNC1I2 (NM_001271789) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit Monoclonal Lambda Light Chain Antibody (IGL/9397R) [Allophycocyanin]
NBP3-24091APC 0.1 mL

Rabbit Monoclonal Lambda Light Chain Antibody (IGL/9397R) [Allophycocyanin]

Sign In for Pricing
View Details
Gpr156 (NM_153394) Mouse Tagged ORF Clone
MG210720 10 µg

Gpr156 (NM_153394) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (PE)
MBS6183740-01 0.1 mL

PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (PE)

Sign In for Pricing
View Details
PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (PE)
MBS6183740-02 5x 0.1 mL

PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (PE)

Sign In for Pricing
View Details