Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB)

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain N315) . Target Name: hlgB. Target Synonyms: H-gamma-1H-gamma-I. Accession Number: P0A075. Expression Region: 26~325aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) is a purified Recombinant Protein.

Accession Number

P0A075

Expression Region

26~325aa

Host

E. coli

Target

HlgB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

H-gamma-1H-gamma-I

Species

Staphylococcus aureus (strain N315)

Protein Name

Recombinant Protein

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS14 Protein Lysate (Rat) with C-HA Tag
39471036 100 µg

RGS14 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC
MBS1492699-01 0.05 mg

Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC
MBS1492699-02 0.1 mg

Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC
MBS1492699-03 5x 0.1 mg

Rabbit anti-human Zinc finger protein 285 polyclonal Antibody, FITC

Sign In for Pricing
View Details
UBPH CRISPR Activation Plasmid (m2)
sc-424309-ACT-2 20 µg

UBPH CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Purified Exosomes: HT1080 Human Fibrosarcoma Cell Line
EXOP-410A-1 50 µg

Purified Exosomes: HT1080 Human Fibrosarcoma Cell Line

Sign In for Pricing
View Details