Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blattella germanica Allergen Bla g 4

Recombinant Blattella germanica Allergen Bla g 4 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Blattella germanica (German cockroach) (Blatta germanica) . Target Name: Blattella germanica Allergen Bla g 4. Target Synonyms: Allergen Bla g IVAllergen: Bla g 4. Accession Number: P54962. Expression Region: 13~182aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Blattella germanica Allergen Bla g 4 is a purified Recombinant Protein.

Accession Number

P54962

Expression Region

13~182aa

Host

E. coli

Target

Blattella germanica Allergen Bla g 4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Bla g IVAllergen: Bla g 4

Species

Blattella germanica (German cockroach) (Blatta germanica)

Protein Name

Recombinant Protein

AA Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fabp7 3'UTR Luciferase Stable Cell Line
TU204206 1.0 mL

Fabp7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DNTP (-dATP)
S504 80 μL

DNTP (-dATP)

Sign In for Pricing
View Details
Chicken NB5R2 ELISA Kit
E104333 1 Each

Chicken NB5R2 ELISA Kit

Sign In for Pricing
View Details
GLIPR1L2 (NM_152436) Human Tagged ORF Clone Lentiviral Particle
RC206894L3V 200 µL

GLIPR1L2 (NM_152436) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Fibronectin,FN ELISA Kit
CN-03198H2 48T

Human Fibronectin,FN ELISA Kit

Sign In for Pricing
View Details
Nat15 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4575802 1.0 µg DNA

Nat15 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details