Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blattella germanica Allergen Bla g 4

Recombinant Blattella germanica Allergen Bla g 4 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Blattella germanica (German cockroach) (Blatta germanica) . Target Name: Blattella germanica Allergen Bla g 4. Target Synonyms: Allergen Bla g IVAllergen: Bla g 4. Accession Number: P54962. Expression Region: 13~182aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Blattella germanica Allergen Bla g 4 is a purified Recombinant Protein.

Accession Number

P54962

Expression Region

13~182aa

Host

E. coli

Target

Blattella germanica Allergen Bla g 4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Bla g IVAllergen: Bla g 4

Species

Blattella germanica (German cockroach) (Blatta germanica)

Protein Name

Recombinant Protein

AA Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zic4 (NM_009576) Mouse Tagged ORF Clone
MR216949 10 µg

Zic4 (NM_009576) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Stradb (NM_001109307) Rat Tagged ORF Clone Lentiviral Particle
RR209720L3V 200 µL

Stradb (NM_001109307) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PON2 Antibody, HRP conjugated
MBS7050096-01 0.05 mg

PON2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PON2 Antibody, HRP conjugated
MBS7050096-02 0.1 mg

PON2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PON2 Antibody, HRP conjugated
MBS7050096-03 5x 0.1 mg

PON2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [Alexa Fluor 350]
NBP2-42656AF350 100 µL

Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [Alexa Fluor 350]

Sign In for Pricing
View Details