Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3; Delta3. Accession Number: Q9NYJ7. Expression Region: 27~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein.

Accession Number

Q9NYJ7

Expression Region

27~492aa

Host

Yeast

Target

DLL3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH4A1 Protein Vector (Human) (pPM-N-D-C-His)
PV321189 500 ng

ALDH4A1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
HP1b antibody (mAb)(Clone 1MOD-1A9)
MBS388656-01 0.1 mg

HP1b antibody (mAb)(Clone 1MOD-1A9)

Sign In for Pricing
View Details
HP1b antibody (mAb)(Clone 1MOD-1A9)
MBS388656-02 5x 0.1 mg

HP1b antibody (mAb)(Clone 1MOD-1A9)

Sign In for Pricing
View Details
ACBD6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
11156156 3x 1.0 µg DNA

ACBD6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Atg2a activation kit by CRISPRa
GA216711 1 Kit

Mouse Atg2a activation kit by CRISPRa

Sign In for Pricing
View Details
Bovine Receptor for Advanced Glycation End Products (RAGE/AGER) ELISA Kit
MBS9397737-01 48 Well

Bovine Receptor for Advanced Glycation End Products (RAGE/AGER) ELISA Kit

Sign In for Pricing
View Details