Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3; Delta3. Accession Number: Q9NYJ7. Expression Region: 27~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein.

Accession Number

Q9NYJ7

Expression Region

27~492aa

Host

Yeast

Target

DLL3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAVEL127X33RL-T3-P21 Pipe Markers for Acids & Bases
N001806 220 Roll (220 Marker (s) x 1 Roll)

JAVEL127X33RL-T3-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
Recombinant Mouse Calsenilin isoform 4 (Kcnip3)
MBS1157759-01 0.02 mg (E-Coli)

Recombinant Mouse Calsenilin isoform 4 (Kcnip3)

Sign In for Pricing
View Details
Recombinant Mouse Calsenilin isoform 4 (Kcnip3)
MBS1157759-02 0.1 mg (E-Coli)

Recombinant Mouse Calsenilin isoform 4 (Kcnip3)

Sign In for Pricing
View Details
Recombinant Mouse Calsenilin isoform 4 (Kcnip3)
MBS1157759-03 0.02 mg (Yeast)

Recombinant Mouse Calsenilin isoform 4 (Kcnip3)

Sign In for Pricing
View Details
Recombinant Mouse Calsenilin isoform 4 (Kcnip3)
MBS1157759-04 0.1 mg (Yeast)

Recombinant Mouse Calsenilin isoform 4 (Kcnip3)

Sign In for Pricing
View Details
Recombinant Mouse Calsenilin isoform 4 (Kcnip3)
MBS1157759-05 0.02 mg (Baculovirus)

Recombinant Mouse Calsenilin isoform 4 (Kcnip3)

Sign In for Pricing
View Details