Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3; Delta3. Accession Number: Q9NYJ7. Expression Region: 27~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein.

Accession Number

Q9NYJ7

Expression Region

27~492aa

Host

Yeast

Target

DLL3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igsf23 (NM_027308) Mouse Tagged ORF Clone Lentiviral Particle
MR213648L3V 200 µL

Igsf23 (NM_027308) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VSV-G tag (10E5) Monoclonal Antibody, HRP Conjugated
bsm-33006M-HRP 100 µL

VSV-G tag (10E5) Monoclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rat Hspb6 / Heat shock protein beta-6 Recombinant Protein
R0871r 1 Each

Rat Hspb6 / Heat shock protein beta-6 Recombinant Protein

Sign In for Pricing
View Details
TRAK1 Rabbit Polyclonal Antibody
E10G01928 100 µL

TRAK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Rho Guanine Nucleotide Exchange Factor 16 Elisa kit
GTR10384300 96 Well

Sheep Rho Guanine Nucleotide Exchange Factor 16 Elisa kit

Sign In for Pricing
View Details
Freezer Storage Box 100 Place for 2 mL micro tubes; Orange, 1 each
BB-3100-01-OR 1/Each

Freezer Storage Box 100 Place for 2 mL micro tubes; Orange, 1 each

Sign In for Pricing
View Details