Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2)

Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DPYSL2. Target Synonyms: Collapsin response mediator protein 2; CRMP-2N2A3Unc-33-like phosphoprotein 2; ULIP-2. Accession Number: Q16555. Expression Region: 1~572aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 64.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2) is a purified Recombinant Protein.

Accession Number

Q16555

Expression Region

1~572aa

Host

Yeast

Target

DPYSL2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Collapsin response mediator protein 2; CRMP-2N2A3Unc-33-like phosphoprotein 2; ULIP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 ARC Goat Polyclonal Antibody
TA302941 100 µg

p21 ARC Goat Polyclonal Antibody

Sign In for Pricing
View Details
Anti-human CD8 Cd8a Monoclonal Antibody PE Conjugated, Flow Validated
FC02236-PE-01 100 Tests

Anti-human CD8 Cd8a Monoclonal Antibody PE Conjugated, Flow Validated

Sign In for Pricing
View Details
Anti-human CD8 Cd8a Monoclonal Antibody PE Conjugated, Flow Validated
FC02236-PE-02 200 Tests

Anti-human CD8 Cd8a Monoclonal Antibody PE Conjugated, Flow Validated

Sign In for Pricing
View Details
LSS Human Over-expression Lysate
orb1342004 100 µg

LSS Human Over-expression Lysate

Sign In for Pricing
View Details
Lesquerolic acid
orb1696541-01 25 mg

Lesquerolic acid

Sign In for Pricing
View Details
Lesquerolic acid
orb1696541-02 50 mg

Lesquerolic acid

Sign In for Pricing
View Details