Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial

Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Saa3. Target Synonyms: Saa3; Serum amyloid A-3 protein. Accession Number: P04918. Expression Region: 20~122aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial is a purified Recombinant Protein.

Accession Number

P04918

Expression Region

20~122aa

Host

Yeast

Target

Saa3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Saa3; Serum amyloid A-3 protein

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)
TRV-0034512-01 20 µL

Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)

Sign In for Pricing
View Details
Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)
TRV-0034512-02 100 µL

Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)

Sign In for Pricing
View Details
Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)
TRV-0034512-03 200 µL

Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)

Sign In for Pricing
View Details
Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)
TRV-0034512-04 1 mL

Monoclonal Antibody to C-Type Natriuretic Peptide (CNP)

Sign In for Pricing
View Details
Urolithin A 10mM * 1mL in DMSO
A20426-10mM-D 10 mM x 1mL in DMSO

Urolithin A 10mM * 1mL in DMSO

Sign In for Pricing
View Details
BIRC6, NT (Baculoviral IAP Repeat-containing Protein 6, Ubiquitin-conjugating BIR Domain Enzyme Apollon, KIAA1289) (FITC) discontinued
B2050-17-FITC 200 µL

BIRC6, NT (Baculoviral IAP Repeat-containing Protein 6, Ubiquitin-conjugating BIR Domain Enzyme Apollon, KIAA1289) (FITC) discontinued

Sign In for Pricing
View Details