Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Toxocara canis 26KDA secreted antigen (TES-26)

Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Toxocara canis (Canine roundworm) . Target Name: TES-26. Target Synonyms: Toxocara excretory-secretory antigen 26; TES-26. Accession Number: P54190. Expression Region: 22~262aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein.

Accession Number

P54190

Expression Region

22~262aa

Host

Yeast

Target

TES-26

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Toxocara excretory-secretory antigen 26; TES-26

Species

Toxocara canis (Canine roundworm)

Protein Name

Recombinant Protein

AA Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCCC1-AS1 ORF Vector (Human) (pORF)
ORF023379 1.0 µg DNA

MCCC1-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans R144.6 Protein (aa 1-345)
VAng-Ly3627-500gEcoli 500 µg (E. coli)

Recombinant Caenorhabditis Elegans R144.6 Protein (aa 1-345)

Sign In for Pricing
View Details
TMEM18 Human qPCR Primer Pair (NM_152834)
HP217977 200 Reactions

TMEM18 Human qPCR Primer Pair (NM_152834)

Sign In for Pricing
View Details
Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein
abx067075-01 10 µg

Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein

Sign In for Pricing
View Details
Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein
abx067075-02 50 µg

Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein

Sign In for Pricing
View Details
Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein
abx067075-03 100 µg

Human Hepatocyte Nuclear Factor 4 Alpha (HNF4a) Protein

Sign In for Pricing
View Details