Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Toxocara canis 26KDA secreted antigen (TES-26)

Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Toxocara canis (Canine roundworm) . Target Name: TES-26. Target Synonyms: Toxocara excretory-secretory antigen 26; TES-26. Accession Number: P54190. Expression Region: 22~262aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein.

Accession Number

P54190

Expression Region

22~262aa

Host

Yeast

Target

TES-26

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Toxocara excretory-secretory antigen 26; TES-26

Species

Toxocara canis (Canine roundworm)

Protein Name

Recombinant Protein

AA Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF1 Over-expression Lysate Product
GWB-E55EEA 0.1 mg

SF1 Over-expression Lysate Product

Sign In for Pricing
View Details
HIF-1 beta Recombinant Antibody, PerCP Conjugated
bsm-52092R-PerCP 100 µL

HIF-1 beta Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
MESDC2 (MESD) (NM_015154) Human Tagged ORF Clone Lentiviral Particle
RC203514L1V 200 µL

MESDC2 (MESD) (NM_015154) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
COPT2 (SLC31A2) Human shRNA Plasmid Kit (Locus ID 1318)
TR309333 1 Kit

COPT2 (SLC31A2) Human shRNA Plasmid Kit (Locus ID 1318)

Sign In for Pricing
View Details
PEX13 Human shRNA Lentiviral Particle (Locus ID 5194)
TL310495V 500 µL Each

PEX13 Human shRNA Lentiviral Particle (Locus ID 5194)

Sign In for Pricing
View Details
Lentiviral human CTRB1 shRNA (UAS) - Lentiviral human CTRB1 shRNA (UAS, RFP) (100)
GTR15317895 1 Vial

Lentiviral human CTRB1 shRNA (UAS) - Lentiviral human CTRB1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details