Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Stress-induced protein SAM22 (PR-10)

Recombinant Glycine max Stress-induced protein SAM22 (PR-10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida) . Target Name: PR-10. Target Synonyms: PR-10; GLYMA_07G243500; Stress-induced protein SAM22; Pathogenesis-related protein 10; Starvation-associated message 22; allergen Gly m 4. Accession Number: P26987. Expression Region: 1~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Glycine max Stress-induced protein SAM22 (PR-10) is a purified Recombinant Protein.

Accession Number

P26987

Expression Region

1~158aa

Host

Yeast

Target

PR-10

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PR-10; GLYMA_07G243500; Stress-induced protein SAM22; Pathogenesis-related protein 10; Starvation-associated message 22; allergen Gly m 4

Species

Glycine max (Soybean) (Glycine hispida)

Protein Name

Recombinant Protein

AA Sequence

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropomyosin 2 Beta (TPM2) Antibody
abx174935-01 200 µg

Tropomyosin 2 Beta (TPM2) Antibody

Sign In for Pricing
View Details
Tropomyosin 2 Beta (TPM2) Antibody
abx174935-02 1 mg

Tropomyosin 2 Beta (TPM2) Antibody

Sign In for Pricing
View Details
Recombinant Human MUSK Protein, N-His
HT224012-01 50 µg

Recombinant Human MUSK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MUSK Protein, N-His
HT224012-02 100 µg

Recombinant Human MUSK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MUSK Protein, N-His
HT224012-03 1 mg

Recombinant Human MUSK Protein, N-His

Sign In for Pricing
View Details
RASL11A siRNA (m)
sc-152712 10 µM

RASL11A siRNA (m)

Sign In for Pricing
View Details