Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Stress-induced protein SAM22 (PR-10)

Recombinant Glycine max Stress-induced protein SAM22 (PR-10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida) . Target Name: PR-10. Target Synonyms: PR-10; GLYMA_07G243500; Stress-induced protein SAM22; Pathogenesis-related protein 10; Starvation-associated message 22; allergen Gly m 4. Accession Number: P26987. Expression Region: 1~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Glycine max Stress-induced protein SAM22 (PR-10) is a purified Recombinant Protein.

Accession Number

P26987

Expression Region

1~158aa

Host

Yeast

Target

PR-10

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PR-10; GLYMA_07G243500; Stress-induced protein SAM22; Pathogenesis-related protein 10; Starvation-associated message 22; allergen Gly m 4

Species

Glycine max (Soybean) (Glycine hispida)

Protein Name

Recombinant Protein

AA Sequence

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat IgM Antibody (HRP)
GWB-5AA29F 1 mg

Cat IgM Antibody (HRP)

Sign In for Pricing
View Details
Monkey Olfactory receptor 9Q2 (OR9Q2) ELISA Kit
GTR10370956 96 Well

Monkey Olfactory receptor 9Q2 (OR9Q2) ELISA Kit

Sign In for Pricing
View Details
GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (APC)
246874-APC 100 µL

GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (APC)

Sign In for Pricing
View Details
hsa-miR-6744-5p miRNA Agomir
MBS8312847-01 5 nmol

hsa-miR-6744-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6744-5p miRNA Agomir
MBS8312847-02 10 nmol

hsa-miR-6744-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6744-5p miRNA Agomir
MBS8312847-03 20 nmol

hsa-miR-6744-5p miRNA Agomir

Sign In for Pricing
View Details