Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostate stem cell antigen (Psca)

Recombinant Mouse Prostate stem cell antigen (Psca) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Psca. Target Synonyms: Psca; Prostate stem cell antigen. Accession Number: P57096. Expression Region: 21~95aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Prostate stem cell antigen (Psca) is a purified Recombinant Protein.

Accession Number

P57096

Expression Region

21~95aa

Host

Yeast

Target

Psca

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Psca; Prostate stem cell antigen

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit
MBS3808210-01 48 Well

Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit

Sign In for Pricing
View Details
Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit
MBS3808210-02 96 Well

Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit

Sign In for Pricing
View Details
Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit
MBS3808210-03 5x 96 Well

Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit

Sign In for Pricing
View Details
Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit
MBS3808210-04 10x 96 Well

Rat Purine Nucleoside Phosphorylase (PNP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-GnRH-R/GNRHR Polyclonal Antibody
PAV7616 100 μL

Rabbit Anti-GnRH-R/GNRHR Polyclonal Antibody

Sign In for Pricing
View Details
PROPAAN150X12CARD-T1-P2 Pipe Markers for Gases
N004443 5 Card (5 Marker (s) x 1 Card)

PROPAAN150X12CARD-T1-P2 Pipe Markers for Gases

Sign In for Pricing
View Details