Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TIMP3. Target Synonyms: Protein MIG-5Tissue inhibitor of metalloproteinases 3; TIMP-3. Accession Number: P35625. Expression Region: 30~208aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial is a purified Recombinant Protein.

Accession Number

P35625

Expression Region

30~208aa

Host

E. coli

Target

TIMP3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein MIG-5Tissue inhibitor of metalloproteinases 3; TIMP-3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B12 Polyclonal Antibody
E55A05024 100 µg

HSD17B12 Polyclonal Antibody

Sign In for Pricing
View Details
ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)
KTE100862-01 48 Tests

ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)

Sign In for Pricing
View Details
ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)
KTE100862-02 96 Tests

ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)

Sign In for Pricing
View Details
ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)
KTE100862-03 5x 96 Well

ELISA kit for Rat TRNA pseudouridine synthase A, mitochondrial (PUS1)

Sign In for Pricing
View Details
Mouse Monoclonal IFN-gamma Antibody (N3-P3A5/A10) [DyLight 650]
NBP2-50435C 0.1 mL

Mouse Monoclonal IFN-gamma Antibody (N3-P3A5/A10) [DyLight 650]

Sign In for Pricing
View Details
IL19 (ZMDA1, Interleukin-19, IL-19, Melanoma Differentiation-associated Protein-like Protein, NG.1) (MaxLight 405)
MBS6382656-01 0.1 mL

IL19 (ZMDA1, Interleukin-19, IL-19, Melanoma Differentiation-associated Protein-like Protein, NG.1) (MaxLight 405)

Sign In for Pricing
View Details