Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TIMP3. Target Synonyms: Protein MIG-5Tissue inhibitor of metalloproteinases 3; TIMP-3. Accession Number: P35625. Expression Region: 30~208aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial is a purified Recombinant Protein.

Accession Number

P35625

Expression Region

30~208aa

Host

E. coli

Target

TIMP3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein MIG-5Tissue inhibitor of metalloproteinases 3; TIMP-3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-04 1 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-05 5 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)
MBS2144800-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details