Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C3 (C3), partial

Recombinant Human Complement C3 (C3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C3. Target Synonyms: C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1. Accession Number: P01024. Expression Region: 26~225aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement C3 (C3), partial is a purified Recombinant Protein.

Accession Number

P01024

Expression Region

26~225aa

Host

E. coli

Target

C3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTR2 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61290R-PE-Cy5.5 100 µL

AGTR2 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human TNNT2 shRNA (UAS) - Lentiviral human TNNT2 shRNA (UAS, RFP) (25)
GTR15342002 1 Vial

Lentiviral human TNNT2 shRNA (UAS) - Lentiviral human TNNT2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Gdf9 Mouse shRNA Plasmid (Locus ID 14566)
TL500790 1 Kit

Gdf9 Mouse shRNA Plasmid (Locus ID 14566)

Sign In for Pricing
View Details
Lipoprotein Receptor-related Protein 6, Low Density, CT (LRP6, FLJ90062, FLJ90421) (FITC)
MBS6485282-01 0.2 mL

Lipoprotein Receptor-related Protein 6, Low Density, CT (LRP6, FLJ90062, FLJ90421) (FITC)

Sign In for Pricing
View Details
Lipoprotein Receptor-related Protein 6, Low Density, CT (LRP6, FLJ90062, FLJ90421) (FITC)
MBS6485282-02 5x 0.2 mL

Lipoprotein Receptor-related Protein 6, Low Density, CT (LRP6, FLJ90062, FLJ90421) (FITC)

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase RIO3, Riok3 ELISA KIT
ELI-07177m 96 Tests

Mouse Serine/threonine-protein kinase RIO3, Riok3 ELISA KIT

Sign In for Pricing
View Details