Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein FUBI (FAU)

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FAU. Target Synonyms: FAU; Ubiquitin-like protein FUBI. Accession Number: NM_001997. Expression Region: 1~133aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein.

Accession Number

NM_001997

Expression Region

1~133aa

Host

E. coli

Target

FAU

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FAU; Ubiquitin-like protein FUBI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human APP/Amyloid beta (ABvac40)
HY235186-01 100 µg

Research Grade Anti-Human APP/Amyloid beta (ABvac40)

Sign In for Pricing
View Details
Research Grade Anti-Human APP/Amyloid beta (ABvac40)
HY235186-02 1 mg

Research Grade Anti-Human APP/Amyloid beta (ABvac40)

Sign In for Pricing
View Details
PEG di (NHS), Mp 6000
26115-5 5 g

PEG di (NHS), Mp 6000

Sign In for Pricing
View Details
Lentiviral mouse Jdp2 shRNA (UAS) - Lentiviral mouse Jdp2 shRNA (UAS, iRFP) plasmid
GTR15228892 1 Vial

Lentiviral mouse Jdp2 shRNA (UAS) - Lentiviral mouse Jdp2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Toll-like receptor 7 polyclonal antibody
ALX-210-874-C100 100 µg

Toll-like receptor 7 polyclonal antibody

Sign In for Pricing
View Details
Band 3 (SLC4A1) (NM_000342) Human Tagged Lenti ORF Clone
RC218312L1 10 µg

Band 3 (SLC4A1) (NM_000342) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details