Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein FUBI (FAU)

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FAU. Target Synonyms: FAU; Ubiquitin-like protein FUBI. Accession Number: NM_001997. Expression Region: 1~133aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein.

Accession Number

NM_001997

Expression Region

1~133aa

Host

E. coli

Target

FAU

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FAU; Ubiquitin-like protein FUBI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apo-SAA1 (Animal Free)
MBS692746-01 0.01 mg

Human Apo-SAA1 (Animal Free)

Sign In for Pricing
View Details
Human Apo-SAA1 (Animal Free)
MBS692746-02 0.05 mg

Human Apo-SAA1 (Animal Free)

Sign In for Pricing
View Details
Human Apo-SAA1 (Animal Free)
MBS692746-03 5x 0.05 mg

Human Apo-SAA1 (Animal Free)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Canine IgE Heavy Chain Secondary Antibody [DyLight 650]
NB7343C 1 mL

Goat Polyclonal Goat anti-Canine IgE Heavy Chain Secondary Antibody [DyLight 650]

Sign In for Pricing
View Details
KOR-1 Peptide
AF4719-BP 1 mg

KOR-1 Peptide

Sign In for Pricing
View Details
Mouse Monoclonal CD7 Antibody (rCD7/6972) [Janelia Fluor 525]
NBP3-20944JF525 0.1 mL

Mouse Monoclonal CD7 Antibody (rCD7/6972) [Janelia Fluor 525]

Sign In for Pricing
View Details