Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3; Delta3. Accession Number: Q9NYJ7. Expression Region: 27~492aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 64.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein.

Accession Number

Q9NYJ7

Expression Region

27~492aa

Host

E. coli

Target

DLL3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3×FLAG-EF1a-CopGFP-Neo Plasmid
PVT54911 2 µg

pLV3×FLAG-EF1a-CopGFP-Neo Plasmid

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-01 1 mg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-02 5 µg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-03 20 µg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-04 100 µg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
TOPORS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2425008 1.0 µg DNA

TOPORS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details