Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E7 (E7)

Recombinant Human papillomavirus type 16 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 16. Target Name: E7. Target Synonyms: E7; Protein E7. Accession Number: P03129. Expression Region: 1~98aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 16 Protein E7 (E7) is a purified Recombinant Protein.

Accession Number

P03129

Expression Region

1~98aa

Host

E. coli

Target

E7

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

E7; Protein E7

Species

Human papillomavirus type 16

Protein Name

Recombinant Protein

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M4C-1000-595-CL-WT Continuous Tape Cartridges for Printers
170842 1 Box (1 Label (s) x 1 Cassette)

M4C-1000-595-CL-WT Continuous Tape Cartridges for Printers

Sign In for Pricing
View Details
MSTN Antibody
orb1329497 100 µg

MSTN Antibody

Sign In for Pricing
View Details
Anti-CTPS antibody
STJ92518 200 µl

Anti-CTPS antibody

Sign In for Pricing
View Details
Phospho-GSK3 Alpha + Beta (Tyr279+Tyr216) Polyclonal Antibody, PE-Cy7 Conjugated
bs-2073R-PE-Cy7 100 µL

Phospho-GSK3 Alpha + Beta (Tyr279+Tyr216) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Bovine 2,3-diphosphoglycerate (2,3-DPG) ELISA Kit
OM622119 96 Strip Well

Bovine 2,3-diphosphoglycerate (2,3-DPG) ELISA Kit

Sign In for Pricing
View Details
CD10 (MME) (NM_000902) Human Recombinant Protein
TP323013M 100 µg

CD10 (MME) (NM_000902) Human Recombinant Protein

Sign In for Pricing
View Details