Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E6 (E6)

Recombinant Human papillomavirus type 16 Protein E6 (E6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 16. Target Name: E6. Target Synonyms: E6; Protein E6. Accession Number: P03126. Expression Region: 1~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 16 Protein E6 (E6) is a purified Recombinant Protein.

Accession Number

P03126

Expression Region

1~158aa

Host

E. coli

Target

E6

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

E6; Protein E6

Species

Human papillomavirus type 16

Protein Name

Recombinant Protein

AA Sequence

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIGR Rabbit Polyclonal Antibody (Fluoro647)
orb3075801 100 µg

PIGR Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
XFD594 Anti-human CD172a Antibody *15-414*
11720161-AAT 500 Tests

XFD594 Anti-human CD172a Antibody *15-414*

Sign In for Pricing
View Details
Isoaesculioside D
MBS5788312 Inquire

Isoaesculioside D

Sign In for Pricing
View Details
Bovine Microtubule-associated tumor suppressor 1 (MTUS1) ELISA Kit
EK9109 48 Tests

Bovine Microtubule-associated tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
Monkey Uridine Phosphorylase 1 (UPP1) ELISA Kit
abx359668 96 Well

Monkey Uridine Phosphorylase 1 (UPP1) ELISA Kit

Sign In for Pricing
View Details
Cynomolgus IL-6 Protein, His Tag
orb1152434-01 1 mg

Cynomolgus IL-6 Protein, His Tag

Sign In for Pricing
View Details