Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aequorea victoria Green fluorescent protein (GFP)

Recombinant Aequorea victoria Green fluorescent protein (GFP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Aequorea victoria (Jellyfish) . Target Name: GFP. Target Synonyms: GFPGreen fluorescent protein. Accession Number: P42212. Expression Region: 1~238aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Aequorea victoria Green fluorescent protein (GFP) is a purified Recombinant Protein.

Accession Number

P42212

Expression Region

1~238aa

Host

E. coli

Target

GFP

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GFPGreen fluorescent protein

Species

Aequorea victoria (Water jellyfish) (Mesonema victoria)

Protein Name

Recombinant Protein

AA Sequence

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IAA21 Antibody
PHY2552S 150 μg

IAA21 Antibody

Sign In for Pricing
View Details
Canine Nucleoporin 43 kDa (NUP43) ELISA Kit
MBS9942508-01 48 Well

Canine Nucleoporin 43 kDa (NUP43) ELISA Kit

Sign In for Pricing
View Details
Canine Nucleoporin 43 kDa (NUP43) ELISA Kit
MBS9942508-02 96 Well

Canine Nucleoporin 43 kDa (NUP43) ELISA Kit

Sign In for Pricing
View Details
Canine Nucleoporin 43 kDa (NUP43) ELISA Kit
MBS9942508-03 5x 96 Well

Canine Nucleoporin 43 kDa (NUP43) ELISA Kit

Sign In for Pricing
View Details
Canine Nucleoporin 43 kDa (NUP43) ELISA Kit
MBS9942508-04 10x 96 Well

Canine Nucleoporin 43 kDa (NUP43) ELISA Kit

Sign In for Pricing
View Details
Plant DNA Replication Licensing Factor MCM5 (MCM5) ELISA Kit
MBS9376591 Inquire

Plant DNA Replication Licensing Factor MCM5 (MCM5) ELISA Kit

Sign In for Pricing
View Details