Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Beta-lactamase CTX-M-1 (bla)

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: bla. Target Synonyms: Beta-lactamase MEN-1Cefotaximase 1. Accession Number: P28585. Expression Region: 29~291aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein.

Accession Number

P28585

Expression Region

29~291aa

Host

E. coli

Target

Bla

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-lactamase MEN-1Cefotaximase 1

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL2 (Peptidylprolyl Isomerase (cyclophilin)-like 2, CYC4, CYP60, Cyp-60, FLJ39930, MGC33174, MGC787, hCyP-60) (FITC)
MBS6178175-01 0.1 mL

PPIL2 (Peptidylprolyl Isomerase (cyclophilin)-like 2, CYC4, CYP60, Cyp-60, FLJ39930, MGC33174, MGC787, hCyP-60) (FITC)

Sign In for Pricing
View Details
PPIL2 (Peptidylprolyl Isomerase (cyclophilin)-like 2, CYC4, CYP60, Cyp-60, FLJ39930, MGC33174, MGC787, hCyP-60) (FITC)
MBS6178175-02 5x 0.1 mL

PPIL2 (Peptidylprolyl Isomerase (cyclophilin)-like 2, CYC4, CYP60, Cyp-60, FLJ39930, MGC33174, MGC787, hCyP-60) (FITC)

Sign In for Pricing
View Details
Kallikrein 14 (KLK14, KLK-L6, Kallikrein-14, hK14, Kallikrein-like Protein 6, KLKL6) (FITC)
MBS6147859-01 0.1 mL

Kallikrein 14 (KLK14, KLK-L6, Kallikrein-14, hK14, Kallikrein-like Protein 6, KLKL6) (FITC)

Sign In for Pricing
View Details
Kallikrein 14 (KLK14, KLK-L6, Kallikrein-14, hK14, Kallikrein-like Protein 6, KLKL6) (FITC)
MBS6147859-02 5x 0.1 mL

Kallikrein 14 (KLK14, KLK-L6, Kallikrein-14, hK14, Kallikrein-like Protein 6, KLKL6) (FITC)

Sign In for Pricing
View Details
Porcine Olfactory receptor 51G1 (OR51G1) ELISA Kit
GTR10363423 96 Well

Porcine Olfactory receptor 51G1 (OR51G1) ELISA Kit

Sign In for Pricing
View Details
CDE-096
B2663-1 1 mg

CDE-096

Sign In for Pricing
View Details